Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.700 2.5e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung cancer 1.300 2.7e-03
malignant mesothelioma 1.200 1.5e-06
osteosarcoma 1.099 3.4e-04
ovarian cancer 1.300 2.5e-04

 Compartment GO Term (1)

AA Sequence

MSRIPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYRGTKRKMLPSSSSRMRSDGFDEESQR      1 - 70
YYWRPKNEISGTLEDDFLKAKSWNKKFYDYEANMPDRWGHSGYKELYPEEFETDSDQQDITNGKKTSPQV     71 - 140
KSSTHESRKHKKSKKSHKKKQKKRSHKKQKKSKKEATDITADSSSEFSEETGASGTRKGKQPHKRKKKSR    141 - 210
KKSLKKPALFLEAESNTSHSDDSASSSSEESEERDTKKTKRKKREKKAHTSVANNEIQERTNKRTNWKVA    211 - 280
TDERSAESSEDD                                                              281 - 292
//

Text Mined References (10)

PMID Year Title