Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 1.1e-03

AA Sequence

MRPLGKGLLPAEELIRSNLGVGRSLRDCLSQSGKLAEELGSKRLKPAKFGTEGKERVEQRTERQRTGSSK      1 - 70
EPRMQIICRRRWREPPPRLLWGCLMPRAQPLLHVTAYENTGHWERLASVVSSKTQQPTVISHSSISITFS     71 - 140
HYPPATLDSFLVLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAV    141 - 210
LSGAQVILVCAEV                                                             211 - 223
//

Text Mined References (3)

PMID Year Title