Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Chromophobe adenocarcinoma 8 4.41 2.2

Synonym

Accession Q6ZUF6
Symbols C6orf227
NCRNA00336

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRAPAQVRTLRWSLGWPGSRGRDVFAALRCAQALRCQPLGSALPPQAPTRDLGRPQAFDSSRTPGPRPPR      1 - 70
STLRMMETKSPTSPSYGARGKVPPGAGPGSPLSRGAGQGAPLSETRFHHVAQAFLKLLSSSNPPTSASES     71 - 140
ARIIGVSHCTQPQVASLSDRHCSKVNHTVLSPRKGVPLQLTAAHSSSQEVLATVPFHG                141 - 198
//

Text Mined References (2)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.