Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Chromophobe renal cell carcinoma 7 4.394 2.2

Synonym

Accession Q6ZUF6
Symbols C6orf227
NCRNA00336

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MRAPAQVRTLRWSLGWPGSRGRDVFAALRCAQALRCQPLGSALPPQAPTRDLGRPQAFDSSRTPGPRPPR      1 - 70
STLRMMETKSPTSPSYGARGKVPPGAGPGSPLSRGAGQGAPLSETRFHHVAQAFLKLLSSSNPPTSASES     71 - 140
ARIIGVSHCTQPQVASLSDRHCSKVNHTVLSPRKGVPLQLTAAHSSSQEVLATVPFHG                141 - 198
//

Text Mined References (2)

PMID Year Title