Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZUA9
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
18976975 Knockdown of FLJ43860 protein by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDRQCSERPYSCTPTGRVSSAVSQNSRISPPVSTSMKDSSCMKVHQDSARRDRWSHPTTILLHKSQSSQA      1 - 70
TLMLQEHRMFMGEAYSAATGFKMLQDMNSADPFHLKYIIKKIKNMAHGSPKLVMETIHDYFIDNPEISSR     71 - 140
HKFRLFQTLEMVIGASDVLEETWEKTFTRLALENMTKATELEDIYQDAASNMLVAICRHSWRVVAQHLET    141 - 210
ELLTGVFPHRSLLYVMGVLSSSEELFSQEDKACWEEQLIQMAIKSVPFLSTDVWSKELLWTLTTPSWTQQ    211 - 280
EQSPEKAFLFTYYGLILQAEKNGATVRRHLQALLETSHQWPKQREGMALTLGLAATRHLDDVWAVLDQFG    281 - 350
RSRPIRWSLPSSSPKNSEDLRWKWASSTILLAYGQVAAKARAHILPWVDNIVSRMVFYFHYSSWDETLKQ    351 - 420
SFLTATLMLMGAVSRSEGAHSYEFFQTSELLQCLMVLMEKEPQDTLCTRSRQQAMHIASSLCKLRPPIDL    421 - 490
ERKSQLLSTCFRSVFALPLLDALEKHTCLFLEPPNIQLWPVARERAGWTHQGWGPRAVLHCSEHLQSLYS    491 - 560
RTMEALDFMLQSLIMQNPTADELHFLLSHLYIWLASEKAHERQRAVHSCMILLKFLNHNGYLDPKEDFKR    561 - 630
IGQLVGILGMLCQDPDRATQRCSLEGASHLYQLLMCHKTGEALQAESQAPKELSQAHSDGAPLWNSRDQK    631 - 700
ATPLGPQEMAKNHIFQLCSFQVIKDIMQQLTLAELSDLIWTAIDGLGSTSPFRVQAASEMLLTAVQEHGA    701 - 770
KLEIVSSMAQAIRLRLCSVHIPQAKEKTLHAITLLARSHTCELVATFLNISIPLDSHTFQLWRALGAGQP    771 - 840
TSHLVLTTLLACLQERPLPTGASDSSPCPKEKTYLRLLAAMNMLHELQFAREFKQAVQEGYPKLFLALLT    841 - 910
QMHYVLELNLPSEPQPKQQAQEAAVPSPQSCSTSLEALKSLLSTTGHWHDFAHLELQGSWELFTTIHTYP    911 - 980
KGVGLLARAMVQNHCRQIPAVLRQLLPSLQSPQERERKVAILILTKFLYSPVLLEVLPKQAALTVLAQGL    981 - 1050
HDPSPEVRVLSLQGLSNILFHPDKGSLLQGQLRPLLDGFFQSSDQVIVCIMGTVSDTLHRLGAQGTGSQS   1051 - 1120
LGVAISTRSFFNDERDGIRAAAMALFGDLVAAMADRELSGLRTQVHQSMVPLLLHLKDQCPAVATQAKFT   1121 - 1190
FYRCAVLLRWRLLHTLFCTLAWERGLSARHFLWTCLMTRSQEEFSIHLSQALSYLHSHSCHIKTWVTLFI   1191 - 1260
GHTICYHPQAVFQMLNAVDTNLLFRTFEHLRSDPEPSIREFATSQLSFLQKVSARPKQ               1261 - 1318
//

Text Mined References (5)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.