Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 7.09928680287499E-15
group 3 medulloblastoma 2254 3.33959653632425E-6
medulloblastoma, large-cell 6234 3.19252537589418E-5
posterior fossa group B ependymoma 1530 1.94388431616889E-4
osteosarcoma 7933 2.27773708781662E-4
tuberculosis 1563 2.32329518179022E-4
ulcerative colitis 2087 5.87957954108968E-4
interstitial cystitis 2299 0.00421801637459922
non primary Sjogren syndrome sicca 840 0.0213879837973723
pancreatic cancer 2300 0.0253510747084687
pancreatic carcinoma 567 0.0253510747084688
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.200 0.025
osteosarcoma -2.246 0.000
group 3 medulloblastoma 2.600 0.000
periodontitis 1.100 0.000
medulloblastoma, large-cell 1.500 0.000
tuberculosis 1.100 0.000
interstitial cystitis 1.800 0.004
posterior fossa group B ependymoma 1.300 0.000
non primary Sjogren syndrome sicca -1.100 0.021
pancreatic carcinoma 1.200 0.025
ulcerative colitis 1.700 0.001

Synonym

Accession Q6ZU80 B9EK52 Q86X97 Q96ML4 Cep128
Symbols C14orf61
LEDP/132
C14orf145

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG

Pathway (1)

Gene RIF (2)

PMID Text
20966902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAESSSESDHFRCRDRLSPWAARSTHRGTRSLPTVEVTEKVNTITSTLQDTSRNLRQVDQMLGRYREYSN      1 - 70
GQAGAIEHLKESLEQSIDQLRSQRLLRNSGGRSISVTSLSASDLDGGTGSELHHFPPTSPLKDYGDPQGI     71 - 140
KRMRSRTGVRFVQETDDMTQLHGFHQSLRDLSSEQIRLGDDFNRELSRRSRSDAETKRALEELTEKLNEA    141 - 210
QKQEVVSDRVERRLQELEREMRTERELVERRQDQLGLMSLQLQEALKKQEAKADEHEGAIKNKLRQTETE    211 - 280
KNQLEQELELSRRLLNQSEGSRETLLHQVEELRTQLTKAEGDRKGLQHQVSQISKQQSNYQDEQGEDWRF    281 - 350
RRGVEREKQDLEKQMSDLRVQLNFSAMASELEEVKRCMERKDKEKAHLASQVENLTRELENGEKQQLQML    351 - 420
DRLKEIQNHFDTCEAERKHADLQISELTRHAEDATKQAERYLSELQQSEALKEEAEKRREDLKLKAQESI    421 - 490
RQWKLKHKKLERALEKQSETVDELTGKNNQILKEKDELKTQLYAALQQIENLRKELNDVLTKRALQEEEL    491 - 560
HSKEEKLRDIKSHQADLELEVKNSLDTIHRLESELKKQSKIQSQMKVEKAHLEEEIAELKKSQAQDKAKL    561 - 630
LEMQESIKDLSAIRADLANKLAEEERAKKAVLKDLSDLTAQAKSRDEETATIITQLKLERDVHQRELKDL    631 - 700
TSSLQSVKTKHEQNIQELMKHFKKEKSEAENHIRTLKAESLEEKNMAKIHRGQLEKLKSQCDRLTEELTQ    701 - 770
NENENKKLKLKYQCLKDQLEEREKHISIEEEHLRRMEEARLQLKDQLLCLETEQESILGVIGKEIDAACK    771 - 840
TFSKDSVEKLKVFSSGPDIHYDPHRWLAESKTKLQWLCEELKERENREKNLRHQLMLCRQQLRNLTENKE    841 - 910
SELQCLFQQIERQEQLLDEIHREKRDLLEETQRKDEEMGSLQDRVIALETSTQVALDHLESVPEKLSLLE    911 - 980
DFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRF    981 - 1050
LSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPKKEEYGS                             1051 - 1094
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...