Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.11
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
group 3 medulloblastoma 1.600 1.8e-05
interstitial cystitis 1.100 2.9e-02
medulloblastoma, large-cell 1.300 1.1e-02
non primary Sjogren syndrome sicca -1.100 2.1e-02
osteosarcoma -2.246 2.3e-04
pancreatic cancer 1.200 2.5e-02
pancreatic carcinoma 1.200 2.5e-02
periodontitis 1.100 7.1e-15
posterior fossa group B ependymoma 1.300 1.9e-04
tuberculosis 1.100 2.3e-04
ulcerative colitis 1.700 5.9e-04

Gene RIF (2)

AA Sequence

MAESSSESDHFRCRDRLSPWAARSTHRGTRSLPTVEVTEKVNTITSTLQDTSRNLRQVDQMLGRYREYSN      1 - 70
GQAGAIEHLKESLEQSIDQLRSQRLLRNSGGRSISVTSLSASDLDGGTGSELHHFPPTSPLKDYGDPQGI     71 - 140
KRMRSRTGVRFVQETDDMTQLHGFHQSLRDLSSEQIRLGDDFNRELSRRSRSDAETKRALEELTEKLNEA    141 - 210
QKQEVVSDRVERRLQELEREMRTERELVERRQDQLGLMSLQLQEALKKQEAKADEHEGAIKNKLRQTETE    211 - 280
KNQLEQELELSRRLLNQSEGSRETLLHQVEELRTQLTKAEGDRKGLQHQVSQISKQQSNYQDEQGEDWRF    281 - 350
RRGVEREKQDLEKQMSDLRVQLNFSAMASELEEVKRCMERKDKEKAHLASQVENLTRELENGEKQQLQML    351 - 420
DRLKEIQNHFDTCEAERKHADLQISELTRHAEDATKQAERYLSELQQSEALKEEAEKRREDLKLKAQESI    421 - 490
RQWKLKHKKLERALEKQSETVDELTGKNNQILKEKDELKTQLYAALQQIENLRKELNDVLTKRALQEEEL    491 - 560
HSKEEKLRDIKSHQADLELEVKNSLDTIHRLESELKKQSKIQSQMKVEKAHLEEEIAELKKSQAQDKAKL    561 - 630
LEMQESIKDLSAIRADLANKLAEEERAKKAVLKDLSDLTAQAKSRDEETATIITQLKLERDVHQRELKDL    631 - 700
TSSLQSVKTKHEQNIQELMKHFKKEKSEAENHIRTLKAESLEEKNMAKIHRGQLEKLKSQCDRLTEELTQ    701 - 770
NENENKKLKLKYQCLKDQLEEREKHISIEEEHLRRMEEARLQLKDQLLCLETEQESILGVIGKEIDAACK    771 - 840
TFSKDSVEKLKVFSSGPDIHYDPHRWLAESKTKLQWLCEELKERENREKNLRHQLMLCRQQLRNLTENKE    841 - 910
SELQCLFQQIERQEQLLDEIHREKRDLLEETQRKDEEMGSLQDRVIALETSTQVALDHLESVPEKLSLLE    911 - 980
DFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRF    981 - 1050
LSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPKKEEYGS                             1051 - 1094
//

Text Mined References (13)

PMID Year Title