Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.200 0.025
osteosarcoma -2.246 0.000
group 3 medulloblastoma 2.600 0.000
periodontitis 1.100 0.000
medulloblastoma, large-cell 1.500 0.000
tuberculosis 1.100 0.000
interstitial cystitis 1.800 0.004
posterior fossa group B ependymoma 1.300 0.000
non primary Sjogren syndrome sicca -1.100 0.021
pancreatic carcinoma 1.200 0.025
ulcerative colitis 1.700 0.001

Synonym

Accession Q6ZU80 B9EK52 Q86X97 Q96ML4 Cep128
Symbols C14orf61
LEDP/132
C14orf145

Gene

Gene RIF (2)

PMID Text
20966902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAESSSESDHFRCRDRLSPWAARSTHRGTRSLPTVEVTEKVNTITSTLQDTSRNLRQVDQMLGRYREYSN      1 - 70
GQAGAIEHLKESLEQSIDQLRSQRLLRNSGGRSISVTSLSASDLDGGTGSELHHFPPTSPLKDYGDPQGI     71 - 140
KRMRSRTGVRFVQETDDMTQLHGFHQSLRDLSSEQIRLGDDFNRELSRRSRSDAETKRALEELTEKLNEA    141 - 210
QKQEVVSDRVERRLQELEREMRTERELVERRQDQLGLMSLQLQEALKKQEAKADEHEGAIKNKLRQTETE    211 - 280
KNQLEQELELSRRLLNQSEGSRETLLHQVEELRTQLTKAEGDRKGLQHQVSQISKQQSNYQDEQGEDWRF    281 - 350
RRGVEREKQDLEKQMSDLRVQLNFSAMASELEEVKRCMERKDKEKAHLASQVENLTRELENGEKQQLQML    351 - 420
DRLKEIQNHFDTCEAERKHADLQISELTRHAEDATKQAERYLSELQQSEALKEEAEKRREDLKLKAQESI    421 - 490
RQWKLKHKKLERALEKQSETVDELTGKNNQILKEKDELKTQLYAALQQIENLRKELNDVLTKRALQEEEL    491 - 560
HSKEEKLRDIKSHQADLELEVKNSLDTIHRLESELKKQSKIQSQMKVEKAHLEEEIAELKKSQAQDKAKL    561 - 630
LEMQESIKDLSAIRADLANKLAEEERAKKAVLKDLSDLTAQAKSRDEETATIITQLKLERDVHQRELKDL    631 - 700
TSSLQSVKTKHEQNIQELMKHFKKEKSEAENHIRTLKAESLEEKNMAKIHRGQLEKLKSQCDRLTEELTQ    701 - 770
NENENKKLKLKYQCLKDQLEEREKHISIEEEHLRRMEEARLQLKDQLLCLETEQESILGVIGKEIDAACK    771 - 840
TFSKDSVEKLKVFSSGPDIHYDPHRWLAESKTKLQWLCEELKERENREKNLRHQLMLCRQQLRNLTENKE    841 - 910
SELQCLFQQIERQEQLLDEIHREKRDLLEETQRKDEEMGSLQDRVIALETSTQVALDHLESVPEKLSLLE    911 - 980
DFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRF    981 - 1050
LSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPKKEEYGS                             1051 - 1094
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...