Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.48
PubTator Score 0.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 0.021
posterior fossa group B ependymoma -2.200 0.000
glioblastoma -2.400 0.001
osteosarcoma -1.598 0.016
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.800 0.016
medulloblastoma, large-cell -1.900 0.036
pediatric high grade glioma -1.600 0.007
pilocytic astrocytoma -1.600 0.002
non primary Sjogren syndrome sicca -1.300 0.017
acute myeloid leukemia -1.200 0.028
pituitary cancer -1.900 0.000

AA Sequence

MEEEMQPAEEGPSVPKIYKQRSPYSVLKTFPSKRPALAKRYERPTLVELPHVRAPPPPPPPFAPHAAVSI      1 - 70
SSSEPPPQQFQAQSSYPPGPGRAAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGP     71 - 140
GAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNE    141 - 210
RQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVD    211 - 280
PLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESI    281 - 350
PVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIR    351 - 420
FVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLREFIRMHCTSNPDWWMPSEEQINKVFSDA    421 - 490
VGHARQGRAVGTFLHNGGSFYEGIDHQASQDEVFNKSSQDGSGD                              491 - 534
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.