Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZU45
Symbols NCRNA00083

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MREWENRNRGLRELEEVAGSSRTREQLVPRLGGRAGYDWWASGEVQSGREEAGEAHPSVAESSLRTRGWG      1 - 70
GDSHAMTASPVPALQLVSSKRDLVLVKEALSWYDAQQHCRLHYTDLADLQPSGLWKLYSLMTSTPAWIGL     71 - 140
FFDASTSGLRWSSGSTFTALEWGQKLPEFGVGFCATLYTWLKLPSIGAASCTAQKPFLCYCGVFTFIFQA    141 - 210
WSFPQGPHSVAQAGVQWCDHSSL                                                   211 - 233
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.