Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZU45
Symbols LINC00083
NCRNA00083

Gene

AA Sequence

MREWENRNRGLRELEEVAGSSRTREQLVPRLGGRAGYDWWASGEVQSGREEAGEAHPSVAESSLRTRGWG      1 - 70
GDSHAMTASPVPALQLVSSKRDLVLVKEALSWYDAQQHCRLHYTDLADLQPSGLWKLYSLMTSTPAWIGL     71 - 140
FFDASTSGLRWSSGSTFTALEWGQKLPEFGVGFCATLYTWLKLPSIGAASCTAQKPFLCYCGVFTFIFQA    141 - 210
WSFPQGPHSVAQAGVQWCDHSSL                                                   211 - 233
//

Text Mined References (2)

PMID Year Title