Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.18977952877358E-10
oligodendroglioma 2849 9.91711437484996E-8
Breast cancer 3099 1.6630775535922E-7
pituitary cancer 1972 1.4747285685872E-6
posterior fossa group B ependymoma 1530 1.77132379284777E-5
primitive neuroectodermal tumor 3031 1.62677991419429E-4
ulcerative colitis 2087 4.69955509806077E-4
primary pancreatic ductal adenocarcinoma 1271 8.55686237167313E-4
ovarian cancer 8492 0.00238907488727357
medulloblastoma, large-cell 6234 0.00402695361538661
pancreatic cancer 2300 0.00585482204012795
ductal carcinoma in situ 1745 0.00619712579607801
gastric carcinoma 832 0.0144886967181049
Endometriosis 535 0.0146322841931228
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0146696375159554
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0227990833652183
Hydrolethalus syndrome 128 0.038925740801103
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Prostate cancer 172 0.0 1.0

Expression

Synonym

Accession Q6ZU35 Q9NTE2 Q9NTP8 Q9ULK9
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MGTRAFSHDSIFIPDGGAESEQTVQAMSQDNILGKVKTLQQQLGKNIKFGQRSPNAIPMNKANSGEASLE      1 - 70
EDLFLTSPMEIVTQQDIVLSDAENKSSDTPSSLSPLNLPGAGSEMEEKVAPVKPSRPKRHFSSAGTIESV     71 - 140
NLDAIPLAIARLDNSAAKHKLAVKPKKQRVSKKHRRLAQDPQHEQGGLESRPCLDQNGHPGEDKPTWHEE    141 - 210
EPNPLDSEEERRRQEDYWRELEAKCKRQKAEAAEKRRLEEQRLQALERRLWEENRRQELLEEEGEGQEPP    211 - 280
LEAERAPREEQQRSLEAPGWEDAERREREERERLEAEEERRRLQAQAQAEERRRLEEDARLEERRRQEEE    281 - 350
EGRCAEELKRQEEEEAEGWEELEQQEAEVQGPPEALEETGEGRRGAEEEDLGEEEEEGQAHLEDWRGQLS    351 - 420
ELLNDFEERLEDQERLKPEGQREHSEEPGICEEQNPEAERRREQQGRSGDFQGADRPGPEEKREEGDTEP    421 - 490
LLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQVSSGGKQILFPKVNLSPVTP    491 - 560
AKDTGLTAAPQEPKAPKASPVQHALPSSLSVPHTAILVTGAQLCGPAVNLSQIKDTACKSLLGLEEKKHA    561 - 630
EAPAGENPPRGPGDARAGSGKAKPRQESPSSASALAEWASIRSRILKNAESDPRSSERDQLRPGDESTPR    631 - 700
GRCDSRGNQRKTPPVNAKFSIMPAWQKFSDGGTETSKQSTEAESIRKRPMLGPSEETAPQPPPAGVRELG    701 - 770
KGPEKSEMHREPADTTEGCKFAKDLPSFLVPSLPYPPQKVVAHTEFTTSSDSETANGIAKPDPVMPGGEE    771 - 840
KASPFGIKLRRTNYSLRFNCDQQAEQKKKKRHSSTGDSADAGPPAAGSARGEKEMEGVALKHGPSLPQER    841 - 910
KQAPSTRRDSAEPSSSRSVPVAHPGPPPASSQTPAPEHDKAANKMPLAQKPALAPKPTSQTPPASPLSKL    911 - 980
SRPYLVELLSRRAGRPDPEPSEPSKEDQESSDRRPPSPPGPEERKGQKRDEEEEATERKPASPPLPATQQ    981 - 1050
EKPSQTPEAGRKEKPMLQSRHSLDGSKLTEKVETAQPLWITLALQKQKGFREQQATREERKQAREAKQAE   1051 - 1120
KLSKENVSVSVQPGSSSVSRAGSLHKSTALPEEKRPETAVSRLERREQLKKANTLPTSVTVEISDSAPPA   1121 - 1190
PLVKEVTKRFSTPDAAPVSTEPAWLALAKRKAKAWSDCPQIIK                              1191 - 1233
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...