Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $205,748
PubMed Score 0.00
PubTator Score 8.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

PMID Text
17922164 SEPT14 maps to 7p11.2 and includes a conserved GTPase domain and a predicted carboxy-terminus coiled-coil domain characteristic of other septins.

AA Sequence

MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLID      1 - 70
TLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYL     71 - 140
QEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNK    141 - 210
IMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCD    211 - 280
FVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEE    281 - 350
ELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQL    351 - 420
STDTKKDKHRKK                                                              421 - 432
//

Text Mined References (5)

PMID Year Title
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
17922164 2007 Characterization of a SEPT9 interacting protein, SEPT14, a novel testis-specific septin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.