Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 8.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
glioblastoma 5792 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Amyotrophic neuralgia 13 3.742 1.9
Disease Target Count
Giant Cell Glioblastoma 12
gliosarcoma 18

Expression

Gene RIF (2)

AA Sequence

MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLID      1 - 70
TLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYL     71 - 140
QEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNK    141 - 210
IMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCD    211 - 280
FVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEE    281 - 350
ELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQL    351 - 420
STDTKKDKHRKK                                                              421 - 432
//

Text Mined References (6)

PMID Year Title