Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 8.32017904730445E-6
pilocytic astrocytoma 3086 4.31683341249438E-5
glioblastoma 5572 4.62658444031848E-5
medulloblastoma 1524 1.03128751988701E-4
adult high grade glioma 2148 4.77622627030231E-4
medulloblastoma, large-cell 6234 0.00122044044619297
astrocytic glioma 2241 0.00624057763738543
oligodendroglioma 2849 0.00663501501370004
ependymoma 2514 0.0140181899807234

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.006
ependymoma -1.300 0.014
oligodendroglioma -1.400 0.007
glioblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.700 0.001
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.200 0.000

Synonym

Accession Q6ZTZ1 C9J6V0
Symbols C4orf44

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKR      1 - 70
NAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPPDWPYYLAIDGILAKVPESCD     71 - 140
GKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEGRFEDDRSDSSSSLLSLKFRSEERPVKKRKV    141 - 210
QSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREVRRVLDQQHILQVQSLQLQERMMSLLERIITKSSV      211 - 278
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.