Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.67
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.5e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 3.2e-03
Disease Target Count Z-score Confidence
Dry eye syndrome 18 3.472 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 3.2e-03
osteosarcoma 1.084 8.5e-04

Gene RIF (1)

AA Sequence

MAAVEKRRQAVPPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEMLRAALLKVLEARPEEPIAFLAHY      1 - 70
FENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNVSVAYECLSAGGRRKRPGLDG     71 - 140
RTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSVFRAGTLTCFVLLEFVARAGALFQLLEDSAA    141 - 210
AVADRRVGQAVLDTLEGALQASDAAAPARFLEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAA    211 - 280
LFIAKVKPVG                                                                281 - 290
//

Text Mined References (8)

PMID Year Title