Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.084 0.001
intraductal papillary-mucinous adenoma (... -1.100 0.003

Synonym

Accession Q6ZTW0 Q96GE2 PGs1
Symbols PGs1
C19orf20
GTRGEO22

Gene

Gene RIF (1)

PMID Text
12972506 Isolation and functional characterization of the mouse PGs1 ortholog, and comparison to the human protein.

AA Sequence

MAAVEKRRQAVPPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEMLRAALLKVLEARPEEPIAFLAHY      1 - 70
FENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNVSVAYECLSAGGRRKRPGLDG     71 - 140
RTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSVFRAGTLTCFVLLEFVARAGALFQLLEDSAA    141 - 210
AVADRRVGQAVLDTLEGALQASDAAAPARFLEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAA    211 - 280
LFIAKVKPVG                                                                281 - 290
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972506 2003 Characterisation of PGs1, a subunit of a protein complex co-purifying with tubulin polyglutamylase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.