Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.78
PubTator Score 16.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.900 2.0e-05
breast carcinoma -1.300 1.9e-11
Endometriosis -1.088 1.9e-02
interstitial cystitis -2.300 9.8e-03
intraductal papillary-mucinous adenoma (... 2.300 8.0e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.100 1.6e-02
non-small cell lung cancer 1.050 2.5e-05
osteosarcoma -1.039 4.9e-03
periodontitis 1.200 7.4e-18
spina bifida -1.133 2.7e-02
tuberculosis -1.600 2.4e-04

Gene RIF (16)

AA Sequence

MLWEETGAAPAPARASDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYEN      1 - 70
QKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQLKIQDEKPFSSFTSMKSSDVFSSKGMTRWGEFDDLYR     71 - 140
ISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYRTMSEAALVRKRMKPLMMDRKERQKNR    141 - 210
ASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKT    211 - 280
DIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEK    281 - 350
AIILKCLQNKLVIKTETTV                                                       351 - 369
//

Text Mined References (27)

PMID Year Title