Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 5.0e-05
interstitial lung disease 1.300 4.0e-03
medulloblastoma, large-cell -1.200 9.5e-06
osteosarcoma -2.366 1.8e-07
pancreatic ductal adenocarcinoma liver m... 1.225 3.2e-03
Pick disease 1.200 6.9e-05

Gene RIF (3)

AA Sequence

MVQLVLQYRDYQRATQRLAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVSKMCPSDVYRVWKRGESLRVD      1 - 70
TSLLGFEHMTWQRGRRSFIFKGQEAGALVMEVDHDRQVVHVETLGLTLQEPETLLAAMRPSEEHVASRLT     71 - 140
SPIVSTHLDTRNVAFERNKCGIWGWRSEKMETVSGYEAKVYSATNVELVTRTRTEHLSDQDKSRSKAGKT    141 - 210
PFQSFLGMAQQHSSHTGAPVQQAASPTNPTAISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSE    211 - 280
EHPLSLGDQVTPIIDLMAISNAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPLSSV    281 - 350
WVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTV    351 - 420
WEALTNTRPGARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEEQLRLALELSS    421 - 490
REQEERERRGQQEEEDLQRILQLSLTEH                                              491 - 518
//

Text Mined References (13)

PMID Year Title