Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZTK2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGWSDLQPAMGGEAERFQAQLEVKLVTGGSPVVFTGNLTRQVGSKLAFSASLSHLLSDQANVTALLERKE      1 - 70
ENGRRVAALGAELFVPGLVGLRALGLLQQQGQLWTNSLRIQYSLLGQAKQAAHECSTSQKLRADSGSDGA     71 - 140
YRLELRHELHCTQILAFSHKVQLWHEEDSGHLHSQLEVSYGKQWDKNSNKRHLRVSQTFKNDSGPALSNH    141 - 210
FMEFVLQVPERQVDCRVQLYHLSLRLPYVESSSHLKVQYNGRPLFVAGGQWKDTSRATLWKWEGVLNLDS    211 - 280
PWLMVSAAHRLYWPHRAVFQAVLELTLGKAWTLKDLVVSVGCRSQGPNREGKIQVYTAATTYLRVSTVTV    281 - 350
LAQSLFHSWSELESAWNTAVQGEIHAENSRDRKILNCWLKGPQQELNLTAAYRHLEWPRKTQVSLTAVWI    351 - 420
GAQGQPRGLQLEGELEELRQDRTLYRKRGALLLRHPLHLPIPQSLLLQETFTADRRHQRYSLETRVVLNG    421 - 490
REETLQTMVLGCQAGHPYVCAGLMHPYDGKVIPRNTEGCLVTWNQHTSLALLSGLESGVQ              491 - 550
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.