Property Summary

NCBI Gene PubMed Count 4
Grant Count 110
R01 Count 80
Funding $16,507,507.5
PubMed Score 86.94
PubTator Score 16.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
oligodendroglioma 1.300 0.024

Synonym

Accession Q6ZTA4 Q5TER7 Q5TER8 Q7Z4K7
Symbols TNL

Gene

PANTHER Protein Class (2)

AA Sequence

MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAGAAAAASLEHD      1 - 70
AAAGPACGGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAA     71 - 140
AARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQL    141 - 210
CDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGG    211 - 280
CKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQ    281 - 350
LSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKL    351 - 420
KMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEFDLT    421 - 490
LDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFR    491 - 560
EVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTA    561 - 630
TCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFM    631 - 700
HCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLE    701 - 770
VPTNLGRPKLSGN                                                             771 - 783
//

Text Mined References (4)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16434393 2006 Subclassification of the RBCC/TRIM superfamily reveals a novel motif necessary for microtubule binding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.