Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $1,112,141.75
PubMed Score 10.50
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZT98 Q5TAX8 Q5TAX9 Q6P990 Q86YS1 Q9H5U4
Symbols

Gene

 Grant Application (2)

PDB

4YLR   4YLS  

AA Sequence

MPSLPQEGVIQGPSPLDLNTELPYQSTMKRKVRKKKKKGTITANVAGTKFEIVRLVIDEMGFMKTPDEDE      1 - 70
TSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQ     71 - 140
FQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILV    141 - 210
TSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIKWFTEF    211 - 280
LQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEI    281 - 350
NRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPGSSDWEQQR    351 - 420
HQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTFLSGRAASFQR    421 - 490
ELNNPLKRMKEEDILDLLEQCEIDDEKLMGKTTKTRGPKPLCSMPESTEIMKRPKYCSSDSSYDSSSSSS    491 - 560
ESDENEKEEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVS    561 - 630
RPTSASRSHSLNRASSYMRHLPHSNDACSTNSQVSESLRQLKTKEQEDDLTSQTLFVLKDMKIRFPGKSD    631 - 700
AESELLIEDIIDNWKYHKTKVASYWLIKLDSVKQRKVLDIVKTSIRTVLPRIWKVPDVEEVNLYRIFNRV    701 - 770
FNRLLWSRGQGLWNCFCDSGSSWESIFNKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYATDKRGSLSGI    771 - 840
GPDWGNSRYLLPGSTQFFLRTPTYNLKYNSPGMTRSNVLFTSRYGHL                           841 - 887
//

Text Mined References (12)

PMID Year Title
25959773 2015 Multivalent Microtubule Recognition by Tubulin Tyrosine Ligase-like Family Glutamylases.
25343990 2015 Genome-wide association study of selenium concentrations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
20061627 2010 Genome-wide scan of copy number variation in late-onset Alzheimer's disease.
16901895 2006 TTLL7 is a mammalian beta-tubulin polyglutamylase required for growth of MAP2-positive neurites.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15890843 2005 Tubulin polyglutamylase enzymes are members of the TTL domain protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...