Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.078 0.003
ependymoma -1.300 0.000
glioblastoma -1.400 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.900 0.001
primitive neuroectodermal tumor -1.700 0.000
pediatric high grade glioma -1.400 0.001
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.306 0.021
Endometriosis -2.018 0.031

Synonym

Accession Q6ZT89 Q8TAV9
Symbols

Gene

Gene RIF (3)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIA      1 - 70
VYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRD     71 - 140
ANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEA    141 - 210
CTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVN    211 - 280
AVRGFPMSAAMFLGYELSLQAIRGDHAVTSP                                           281 - 311
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.