Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.20746652455121E-7
pilocytic astrocytoma 3086 9.82481096559337E-7
ependymoma 2514 3.23301338133414E-6
glioblastoma 5572 2.94271964805552E-5
sonic hedgehog group medulloblastoma 1482 5.07220321521382E-5
primitive neuroectodermal tumor 3031 4.6886563720071E-4
pediatric high grade glioma 2712 5.78642444890798E-4
medulloblastoma, large-cell 6234 9.59301695039012E-4
osteosarcoma 7933 0.00281626364896662
subependymal giant cell astrocytoma 2287 0.0212650843235789
Endometriosis 535 0.030770380462114

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.078 0.003
ependymoma -1.300 0.000
glioblastoma -1.400 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.900 0.001
primitive neuroectodermal tumor -1.700 0.000
pediatric high grade glioma -1.400 0.001
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.306 0.021
Endometriosis -2.018 0.031

Synonym

Accession Q6ZT89 Q8TAV9
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (3)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSFQLEDFAAGWIGGAASVIVGHPLDTVKTRLQAGVGYGNTLSCIRVVYRRESMFGFFKGMSFPLASIA      1 - 70
VYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLIKIRLQMQTQPFRD     71 - 140
ANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGYCLYFIPYVFLSEWITPEA    141 - 210
CTGPSPCAVWLAGGMAGAISWGTATPMDVVKSRLQADGVYLNKYKGVLDCISQSYQKEGLKVFFRGITVN    211 - 280
AVRGFPMSAAMFLGYELSLQAIRGDHAVTSP                                           281 - 311
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.