Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZT83
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGALNSISLETNKSSFSMSWTPSVEHSSGTARTLRSCKLALVGFSSMSEFLFRASKTQPVTLFVPNVNSA      1 - 70
LCDQPVVRGVGIHEQRKRNISSLISVFNHWLPPLQLHLGRALICRFNSRGNFTCLMTAVK               71 - 130
//

Text Mined References (2)

PMID Year Title