Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZT83
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGALNSISLETNKSSFSMSWTPSVEHSSGTARTLRSCKLALVGFSSMSEFLFRASKTQPVTLFVPNVNSA      1 - 70
LCDQPVVRGVGIHEQRKRNISSLISVFNHWLPPLQLHLGRALICRFNSRGNFTCLMTAVK               71 - 130
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.