Property Summary

NCBI Gene PubMed Count 15
PubMed Score 240.97
PubTator Score 65.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
juvenile dermatomyositis 1189 9.81146721516035E-10
osteosarcoma 7933 2.52856010612077E-6
cystic fibrosis 1670 2.60271638835913E-5
pituitary cancer 1972 1.5946876781735E-4
acute quadriplegic myopathy 1157 1.85623796662118E-4
group 4 medulloblastoma 1875 2.08303312855939E-4
ulcerative colitis 2087 4.05937658255308E-4
atypical teratoid / rhabdoid tumor 4369 0.00145166591120409
ovarian cancer 8492 0.00317115748934148
oligodendroglioma 2849 0.00705962303655761
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00778721551359606
Rheumatoid Arthritis 1171 0.0274976170654766
primitive neuroectodermal tumor 3031 0.0441218063491881
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Anorexia nervosa 59 0.0 2.0
Disease Target Count
Aural atresia, congenital 1

Expression

  Differential Expression (13)

Synonym

Accession Q6ZSZ6 O60534 Q4LE29 Q53EU4
Symbols CAA
TSH1
NY-CO-33
SDCCAG33

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
26621817 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
25918232 TSHZ1 levels are reduced in human islets of donors with type 2 diabetes
24487590 TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2.
22152683 Together, these results demonstrate that hemizygosity of TSHZ1 leads to congenital aural atresia as a result of haploinsufficiency
21874228 a significant up-regulation of BORIS (p<0.001) and TSHZ1 transcripts (p<0.05) for JAs compared to nasal mucosa.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17586487 This publication characterizes the mouse ortholog of the human teashirt zinc finger homeobox 1 gene and proposes that the human gene may be a candidate gene for CAA syndrome.

AA Sequence

MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQNSPVSSATNQ      1 - 70
DAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSG     71 - 140
STTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQ    141 - 210
TSSYGLLPEPSLFSTVQLYRQNNKLYGSVFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDS    211 - 280
EKTKRWSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPS    281 - 350
TKKRALQDLAPPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME    351 - 420
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPASSIKKQPDSP    421 - 490
AGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREEDLDDSPKGGLDILKSLENTVS    491 - 560
TAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQVQPSYAGGVKSLSSAEHNALLHSPGSLTPP    561 - 630
PHKSNVSAMEELVEKVTGKVNIKKEERPPEKEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETG    631 - 700
KAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDP    701 - 770
LAMLYKISNSMLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI    771 - 840
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLILQAQFASSLRE    841 - 910
TTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPVFFCNDCASQFR    911 - 980
TASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTNKTLGPLGATEEDLGSTFQCKLCNRTFASKH    981 - 1050
AVKLHLSKTHGKSPEDHLIYVTELEKQ                                              1051 - 1077
//

Text Mined References (18)

PMID Year Title
26621817 2015 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
25918232 2015 Tshz1 Regulates Pancreatic ?-Cell Maturation.
24487590 2014 TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22152683 2011 Disruption of teashirt zinc finger homeobox 1 is associated with congenital aural atresia in humans.
21874228 2011 Genome-wide copy number profiling using a 100K SNP array reveals novel disease-related genes BORIS and TSHZ1 in juvenile angiofibroma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...