Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
R01 Count 3
Funding $671,534.95
PubMed Score 240.97
PubTator Score 65.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (7)

PMID Text
26621817 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
25918232 TSHZ1 levels are reduced in human islets of donors with type 2 diabetes
24487590 TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2.
22152683 Together, these results demonstrate that hemizygosity of TSHZ1 leads to congenital aural atresia as a result of haploinsufficiency
21874228 a significant up-regulation of BORIS (p<0.001) and TSHZ1 transcripts (p<0.05) for JAs compared to nasal mucosa.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17586487 This publication characterizes the mouse ortholog of the human teashirt zinc finger homeobox 1 gene and proposes that the human gene may be a candidate gene for CAA syndrome.

AA Sequence

MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQNSPVSSATNQ      1 - 70
DAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSG     71 - 140
STTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQ    141 - 210
TSSYGLLPEPSLFSTVQLYRQNNKLYGSVFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDS    211 - 280
EKTKRWSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPS    281 - 350
TKKRALQDLAPPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME    351 - 420
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPASSIKKQPDSP    421 - 490
AGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREEDLDDSPKGGLDILKSLENTVS    491 - 560
TAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQVQPSYAGGVKSLSSAEHNALLHSPGSLTPP    561 - 630
PHKSNVSAMEELVEKVTGKVNIKKEERPPEKEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETG    631 - 700
KAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDP    701 - 770
LAMLYKISNSMLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI    771 - 840
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLILQAQFASSLRE    841 - 910
TTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFLKNLDTGHPVFFCNDCASQFR    911 - 980
TASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTNKTLGPLGATEEDLGSTFQCKLCNRTFASKH    981 - 1050
AVKLHLSKTHGKSPEDHLIYVTELEKQ                                              1051 - 1077
//

Text Mined References (18)

PMID Year Title
26621817 2015 Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.
25918232 2015 Tshz1 Regulates Pancreatic ?-Cell Maturation.
24487590 2014 TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22152683 2011 Disruption of teashirt zinc finger homeobox 1 is associated with congenital aural atresia in humans.
21874228 2011 Genome-wide copy number profiling using a 100K SNP array reveals novel disease-related genes BORIS and TSHZ1 in juvenile angiofibroma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...