Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.69
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (8)

PMID Text
26217016 CRB3A recruits p114RhoGEF and its activator Ehm2 to the cell periphery using both functional motifs of its cytoplasmic tail and increases RhoA activation levels.
23648482 LKB1 and p114RhoGEF control RhoA activity in bronchial epithelial cells to promote apical junction assembly.
23185572 Stimulation of cortical myosin phosphorylation by p114RhoGEF drives cell migration and tumor cell invasion.
22006950 In its regulation of the circumferential actomyosin tensile system, Lulu2 interacts with and activates p114RhoGEF at apical cell-cell junctions.
21258369 Data indicate that p114RhoGEF is a component of a junction-associated Rho signalling module that drives spatially restricted activation of RhoA to regulate junction formation and epithelial morphogenesis.
20810787 p114-RhoGEF and Lfc are critically involved in Wnt-3a- and Dvl-induced RhoA activation and neurite retraction in N1E-115 cells.
20200978 Observational study of gene-disease association. (HuGE Navigator)
14512443 data showed that the novel guanine nucleotide exchange factor p114RhoGEF regulates the activity of RhoA and Rac1, and that Gbetagamma subunits of heterotrimeric G proteins are activators of p114RhoGEF under physiological conditions

AA Sequence

MVTVGTNILPSRPAASANTAREDAALFSRRIPPRHKNGAAQPGAAPGPGAPGANMGNAHSKSGDRHSALP      1 - 70
GRPELSFYGSFPRKWSENVFLDNELLTSKILSVLRPQSERGFRAGDLRYPTHFLSTNSVLASVTASLKEH     71 - 140
PRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSP    141 - 210
NTESIFVEDPYTASLRSEIESDGHEFEAESWSLAVDAAYAKKQKREVVKRQDVLYELMQTEVHHVRTLKI    211 - 280
MLKVYSRALQEELQFSSKAIGRLFPCADDLLETHSHFLARLKERRQESLEEGSDRNYVIQKIGDLLVQQF    281 - 350
SGENGERMKEKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGNFSIVRRLGVQECILLVTQRITKYPV    351 - 420
LVERIIQNTEAGTEDYEDLTQALNLIKDIISQVDAKVSECEKGQRLREIAGKMDLKSSSKLKNGLTFRKE    421 - 490
DMLQRQLHLEGMLCWKTTSGRLKDILAILLTDVLLLLQEKDQKYVFASVDSKPPVISLQKLIVREVANEE    491 - 560
KAMFLISASLQGPEMYEIYTSSKEDRNAWMAHIQRAVESCPDEEEGPFSLPEEERKVVEARATRLRDFQE    561 - 630
RLSMKDQLIAQSLLEKQQIYLEMAEMGGLEDLPQPRGLFRGGDPSETLQGELILKSAMSEIEGIQSLICR    631 - 700
QLGSANGQAEDGGSSTGPPRRAETFAGYDCTNSPTKNGSFKKKVSSTDPRPRDWRGPPNSPDLKLSDSDI    701 - 770
PGSSEESPQVVEAPGTESDPRLPTVLESELVQRIQTLSQLLLNLQAVIAHQDSYVETQRAAIQEREKQFR    771 - 840
LQSTRGNLLLEQERQRNFEKQREERAALEKLQSQLRHEQQRWERERQWQHQELERAGARLQEREGEARQL    841 - 910
RERLEQERAELERQRQAYQHDLERLREAQRAVERERERLELLRRLKKQNTAPGALPPDTLAEAQPPSHPP    911 - 980
SFNGEGLEGPRVSMLPSGVGPEYAERPEVARRDSAPTENRLAKSDVPIQLLSATNQFQRQAAVQQQIPTK    981 - 1050
LAASTKGGKDKGGKSRGSQRWESSASFDLKQQLLLNKLMGKDESTSRNRRSLSPILPGRHSPAPPPDPGF   1051 - 1120
PAPSPPPADSPSEGFSLKAGGTALLPGPPAPSPLPATPLSAKEDASKEDVIFF                    1121 - 1173
//

Text Mined References (25)

PMID Year Title
26217016 2015 CRB3A Controls the Morphology and Cohesion of Cancer Cells through Ehm2/p114RhoGEF-Dependent Signaling.
23648482 2013 LKB1 controls human bronchial epithelial morphogenesis through p114RhoGEF-dependent RhoA activation.
23185572 2012 Stimulation of cortical myosin phosphorylation by p114RhoGEF drives cell migration and tumor cell invasion.
22445761 2012 Genome-wide association study of SSRI/SNRI-induced sexual dysfunction in a Japanese cohort with major depression.
22006950 2011 Lulu2 regulates the circumferential actomyosin tensile system in epithelial cells through p114RhoGEF.
21269460 2011 Initial characterization of the human central proteome.
21258369 2011 Spatially restricted activation of RhoA signalling at epithelial junctions by p114RhoGEF drives junction formation and morphogenesis.
20810787 2010 Involvement of p114-RhoGEF and Lfc in Wnt-3a- and dishevelled-induced RhoA activation and neurite retraction in N1E-115 mouse neuroblastoma cells.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...