Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.49
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.16678419998267E-17
atypical teratoid / rhabdoid tumor 4369 1.96621310572133E-13
glioblastoma 5572 2.2499445055268E-11
pilocytic astrocytoma 3086 3.47249338951688E-10
adult high grade glioma 2148 2.32614397760951E-8
sonic hedgehog group medulloblastoma 1482 1.43985196295607E-7
medulloblastoma, large-cell 6234 1.53614808082246E-6
primitive neuroectodermal tumor 3031 1.97527137227929E-4
primary pancreatic ductal adenocarcinoma 1271 0.04126990168724

Expression

  Differential Expression (9)

Synonym

Accession Q6ZSY5 A2VDJ8 B3KPW2 E9PCM3 R3F
Symbols R3F
HB2E
LL0XNC01-7P3.1

Gene

  Ortholog (6)

Gene RIF (3)

PMID Text
20479760 Observational study of gene-disease association. (HuGE Navigator)
20398921 Observational study of gene-disease association. (HuGE Navigator)
8938429 Maps this gene as HB2E at the DXS9823E marker sequence.

AA Sequence

MARTAPVEPPLRHSAPPSPAAGEPRTSVEAAVAPRRVLFADEALGLPLAQLRRYRPWGGPGAGKMAAAAG      1 - 70
QDGGGGGGADEDDDGEDGDEGEEEEEACPEPSPLCPVPAGGGFYLVPTFSLPPAPGRLERLGRVMVELEA     71 - 140
LLPPPGAVPGGAGVWVPGGRPPVLRGLVRVLNRSFEKAVHVRASHDGWASFCDHPARYVPRSPPWAGAGG    141 - 210
TGAGDPILDPGLGLGPGQASASSPDDGGRTDRFAFQLPFAEGAGDGARLDFVVRYETPEGTFWANNHGRN    211 - 280
YTVLLRIAPAPTPTDAEGLPQQQQLPQLEPQPECQGPVEAEARQLKSCMKPVRRRPAEEELKTKNMDDNT    281 - 350
FAMAEHPDVQESVGPLVAPTPLRPWPQMTLQVSDVPMTGNPAEEGDVPRSSPPVAFTEVLQAPAIRIPPS    351 - 420
SPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQ    421 - 490
LYLSHLSRLRAAVAAGGAGGGGEGSTDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARL    491 - 560
GRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGDVWLPWAEGSGCDGPV    561 - 630
VLGTEGQFIGDPEKGMGKDTSSLHMNRVIAGVTESLGEAGTEAQIEVTSEWAGSLDPISGKEPASPVLLQ    631 - 700
GQNPTLLSPLGAEVCLSSVARPHVSSQDEKDAGPSLEPPKKSPTLAVPAECVCALPPQLRGPLTQTLGVL    701 - 770
AGLVVVPVALNSGVSLLVLALCLSLAWFS                                             771 - 799
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
21668450 2011 R3F, a novel membrane-associated glycogen targeting subunit of protein phosphatase 1 regulates glycogen synthase in astrocytoma cells in response to glucose and extracellular signals.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
20398921 2010 Genetic variants harbored in the forkhead box protein 3 locus increase hay fever risk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...