Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.49
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 2.3e-08
Astrocytoma, Pilocytic -1.400 2.5e-10
atypical teratoid / rhabdoid tumor -1.800 2.0e-13
ependymoma -1.100 1.6e-02
glioblastoma -1.500 2.2e-11
medulloblastoma, large-cell -1.500 1.5e-06
primary pancreatic ductal adenocarcinoma -1.092 4.1e-02
primitive neuroectodermal tumor -1.200 2.0e-04
sonic hedgehog group medulloblastoma -1.400 1.4e-07

Gene RIF (3)

AA Sequence

MARTAPVEPPLRHSAPPSPAAGEPRTSVEAAVAPRRVLFADEALGLPLAQLRRYRPWGGPGAGKMAAAAG      1 - 70
QDGGGGGGADEDDDGEDGDEGEEEEEACPEPSPLCPVPAGGGFYLVPTFSLPPAPGRLERLGRVMVELEA     71 - 140
LLPPPGAVPGGAGVWVPGGRPPVLRGLVRVLNRSFEKAVHVRASHDGWASFCDHPARYVPRSPPWAGAGG    141 - 210
TGAGDPILDPGLGLGPGQASASSPDDGGRTDRFAFQLPFAEGAGDGARLDFVVRYETPEGTFWANNHGRN    211 - 280
YTVLLRIAPAPTPTDAEGLPQQQQLPQLEPQPECQGPVEAEARQLKSCMKPVRRRPAEEELKTKNMDDNT    281 - 350
FAMAEHPDVQESVGPLVAPTPLRPWPQMTLQVSDVPMTGNPAEEGDVPRSSPPVAFTEVLQAPAIRIPPS    351 - 420
SPLCGLGGSPRDQASGPDASEGATGPFLEPSQQQAEATWGVSSENGGGLEAVSGSEELLGEDTIDQELEQ    421 - 490
LYLSHLSRLRAAVAAGGAGGGGEGSTDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARL    491 - 560
GRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGDVWLPWAEGSGCDGPV    561 - 630
VLGTEGQFIGDPEKGMGKDTSSLHMNRVIAGVTESLGEAGTEAQIEVTSEWAGSLDPISGKEPASPVLLQ    631 - 700
GQNPTLLSPLGAEVCLSSVARPHVSSQDEKDAGPSLEPPKKSPTLAVPAECVCALPPQLRGPLTQTLGVL    701 - 770
AGLVVVPVALNSGVSLLVLALCLSLAWFS                                             771 - 799
//

Text Mined References (12)

PMID Year Title