Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZST8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MMRSIFLPHRKLICSRRGHLDPRGWEEDEKILVPDAIPTLPPYVFIRTDQACVKVYPGFVLIRNGKTHRH      1 - 70
RGDCHEEEVCAHRTLETGGMACHVGPHGEGPSLWGFWGSWKQVLFFLPVDH                        71 - 121
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.