Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MLLLNQTLATTEKQTALQAAEKFVDELCISYSAKKGRGYARKRQKNLLATLQAYKPQNPKDAPVNCDKCG      1 - 70
KPGNVKNDCPGSMRKPARPCPICGGDHWRVDCPQRCRSLGPKPVSQVSNRIDGPQGSCPWL              71 - 131
//

Text Mined References (1)

PMID Year Title