Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.91
PubTator Score 18.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.52779665095177E-16
atypical teratoid/rhabdoid tumor 1095 5.66522394785458E-11
medulloblastoma, large-cell 6234 6.7028297973079E-8
malignant mesothelioma 3163 1.97087387284968E-7
medulloblastoma 1524 2.79836975657008E-7
pediatric high grade glioma 2712 8.1382512345581E-6
psoriasis 6685 8.55076959543481E-5
glioblastoma 5572 1.74088370228889E-4
osteosarcoma 7933 9.14617584961076E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00109663730943069
primitive neuroectodermal tumor 3031 0.00166853252268853
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00184349837769254
primary pancreatic ductal adenocarcinoma 1271 0.00541135085670603
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00575387675608416
astrocytic glioma 2241 0.00756119972879584
Endometriosis 535 0.0146204104761794
Pick disease 1893 0.0183914811568576
subependymal giant cell astrocytoma 2287 0.0315733568545116
oligodendroglioma 2849 0.0319465924576672
aldosterone-producing adenoma 664 0.0335296395563959
Breast cancer 3099 0.0412422747541486
X-linked cerebral adrenoleukodystrophy 115 0.0446396507794023
Disease Target Count Z-score Confidence
Mumps 10 6.297 3.1
Rubella 14 5.99 3.0
Measles 20 5.896 2.9
Loeys-Dietz syndrome 23 3.197 1.6

Expression

Synonym

Accession Q6ZSS7 D3KSZ4 Q86TH2 Q9NXM3
Symbols MMR2
hMMR2

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
20978832 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLI      1 - 70
SKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLL     71 - 140
CWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSD    141 - 210
TVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYD    211 - 280
QQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTH    281 - 350
IEVLIDGKGCKPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESS    351 - 420
EETPTTTSHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSH    421 - 490
VSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSA    491 - 560
AVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWLAVPDEEE    561 - 630
DKTMLAERIPVPSSPVPIATIDLVQQQTEDVMPRIEPRLPPKKTKHQEEQEDVNKPAWGVSSSPWVTFVY    631 - 700
ALYQIKEMMQLTRDNRASEIQPLQGTNENRENSPAGRAQPVPCETHSDPSRNQPSPDAAASQTQTSPAHP    701 - 770
SVDPCTEESEEQQAQLAAGGH                                                     771 - 791
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20978832 2011 Gene-environment interaction in the etiology of mathematical ability using SNP sets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20123006 2010 HLA-B62 as a possible ligand for the human homologue of mouse macrophage MHC receptor 2 (MMR2) on monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...