Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MGTKGLPLYPDPSRVPGTKTQNNLESDYLARDGPSSNSSFHSSEEEGTDLEGDMLDCSGSRPLLMESEEE      1 - 70
DESCRPPPGKLGGAVPFAPPEVSPEQAKTVQGGRKNQFQAFTQPATDGLSEPDVFAIAPFRSSRVPNDDM     71 - 140
DIFSKAPFVSKSSMAPSQPEESDVFLRAPFTKKKSMEELTVIQCTSQELPAQTGLLSQTGDVPLPAGRER    141 - 210
AVYTSVQAQYSTAGFVQQSNLLSHSVQAADHLDSISPRGSCLESGGHSNDRNKGPQLQKEAVSGPMAGKP    211 - 280
FRPQSLSKYSRHYSPEDEPSPEAQPIAAYKIVSQTNKQSIAGSVSITSLSSRTTELPAADPFALAPFPSK    281 - 350
SGKKP                                                                     351 - 355
//

Text Mined References (2)

PMID Year Title