Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.46
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000
non-small cell lung carcinoma -1.500 0.000

Gene RIF (6)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of solute carrier family 16, member 12 (SLC16A12) in primary human brain microvascular endothelial cells
23578822 study identified a second creatine transporter monocarboxylate transporter 12 (MCT12), encoded by the cataract and glucosuria associated gene SLC16A12; Rssults show SLC6A8 was predominantly found in brain, heart and muscle, while SLC16A12 was more abundant in kidney and retina. In the lens, the two transcripts were found at comparable levels.
20181839 The monocarboxylate transporter SLC16A12 may contribute to age-related cataract. Sequences within the 5'UTR modulate translational efficiency with pathogenic consequences.
20181839 Observational study of gene-disease association. (HuGE Navigator)
18304496 SLC16A12 is important for lens and kidney homeostasis; its potential role in age-related cataract is discussed.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKVNRARSTSPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTML      1 - 70
CAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSR     71 - 140
RKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPEQNH    141 - 210
VCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYALS    211 - 280
VGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMDGLCYLCLPMLQSLPLLVPFS    281 - 350
CTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTTGSYTAAFLLCGFSM    351 - 420
IFSSVLLGFARLIKRMRKTQLQFIAKESDPKLQLWTNGSVAYSVARELDQKHGEPVATAVPGYSLT        421 - 486
//

Text Mined References (9)

PMID Year Title
23578822 2013 The cataract and glucosuria associated monocarboxylate transporter MCT12 is a new creatine transporter.
20181839 2010 Alterations of the 5'untranslated region of SLC16A12 lead to age-related cataract.
18304496 2008 Mutation of solute carrier SLC16A12 associates with a syndrome combining juvenile cataract with microcornea and renal glucosuria.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739169 2004 The SLC16 gene family-from monocarboxylate transporters (MCTs) to aromatic amino acid transporters and beyond.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.