Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.84
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.500 1.7e-03
Astrocytoma, Pilocytic -2.600 6.6e-04
atypical teratoid / rhabdoid tumor -2.600 7.5e-04
ependymoma -1.800 1.7e-03
glioblastoma -1.700 1.5e-02
group 4 medulloblastoma -1.900 2.0e-02
interstitial cystitis -2.400 4.1e-04
medulloblastoma, large-cell -1.800 4.8e-02

Gene RIF (1)

AA Sequence

MALRRLLLLLLLSLESLDLLPSVHGARGRAANRTLSAGGAAVGGRRAGGALARGGRELNGTARAPGIPEA      1 - 70
GSRRGQPAAAVAAAASAAVTYETCWGYYDVSGQYDKEFECNNSESGYLYCCGTCYYRFCCKKRHEKLDQR     71 - 140
QCTNYQSPVWVQTPSTKVVSPGPENKYDPEKDKTNFTVYITCGVIAFVIVAGVFAKVSYDKAHRPPREMN    141 - 210
IHRALADILRQQGPIPIAHCERETISAIDTSPKENTPVRSSSKNHYTPVRTAKQTPEKPRMNNILTSATE    211 - 280
PYDLSFSRSFQNLAHLPPSYESAVKTNPSKYSSLKRLTDKEADEYYMRRRHLPDLAARGTLPLNVIQMSQ    281 - 350
QKPLPRERPRRPIRAMSQDRVLSPDRGLPDEFSMPYDRILSDEQLLSTERLHSQDPLLSPERTAFPEQSL    351 - 420
SRAISHTDVFVSTPVLDRYRMSKMHSHPSASNNSYATLGQSQTAAKRHAFASRRHNTVEQLHYIPGHHTC    421 - 490
YTASKTEVTV                                                                491 - 500
//

Text Mined References (10)

PMID Year Title