Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.84
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.800 0.002
glioblastoma -2.700 0.011
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -1.800 0.048
interstitial cystitis -2.400 0.000
pediatric high grade glioma -3.000 0.000
group 4 medulloblastoma -1.900 0.020
pilocytic astrocytoma -2.500 0.001

Synonym

Accession Q6ZSJ9 B3KXV5 Q4PL63
Symbols

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MALRRLLLLLLLSLESLDLLPSVHGARGRAANRTLSAGGAAVGGRRAGGALARGGRELNGTARAPGIPEA      1 - 70
GSRRGQPAAAVAAAASAAVTYETCWGYYDVSGQYDKEFECNNSESGYLYCCGTCYYRFCCKKRHEKLDQR     71 - 140
QCTNYQSPVWVQTPSTKVVSPGPENKYDPEKDKTNFTVYITCGVIAFVIVAGVFAKVSYDKAHRPPREMN    141 - 210
IHRALADILRQQGPIPIAHCERETISAIDTSPKENTPVRSSSKNHYTPVRTAKQTPEKPRMNNILTSATE    211 - 280
PYDLSFSRSFQNLAHLPPSYESAVKTNPSKYSSLKRLTDKEADEYYMRRRHLPDLAARGTLPLNVIQMSQ    281 - 350
QKPLPRERPRRPIRAMSQDRVLSPDRGLPDEFSMPYDRILSDEQLLSTERLHSQDPLLSPERTAFPEQSL    351 - 420
SRAISHTDVFVSTPVLDRYRMSKMHSHPSASNNSYATLGQSQTAAKRHAFASRRHNTVEQLHYIPGHHTC    421 - 490
YTASKTEVTV                                                                491 - 500
//

Text Mined References (10)

PMID Year Title
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16473350 2006 Identification of novel genes regulated in the developing human ventral mesencephalon.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.