Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.04
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.015 0.002
ovarian cancer 1.200 0.010
Breast cancer 1.100 0.000

Gene RIF (1)

PMID Text
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEWGPGSDWSRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGR      1 - 70
RRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP                                   71 - 110
//

Text Mined References (5)

PMID Year Title
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.