Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.04
PubTator Score 0.04

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
Breast cancer 3578 1.3e-05
ovarian cancer 8520 9.3e-05
osteosarcoma 7950 1.5e-03


  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.100 1.3e-05
osteosarcoma 1.015 1.5e-03
ovarian cancer -1.100 9.3e-05

Gene RIF (1)

AA Sequence

RRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP                                   71 - 110

Text Mined References (5)

PMID Year Title