Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.39
PubTator Score 0.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-02
Astrocytoma, Pilocytic -1.600 2.7e-05
atypical teratoid / rhabdoid tumor -2.700 9.7e-04
ependymoma -1.300 9.9e-05
glioblastoma -1.100 2.5e-03
group 3 medulloblastoma 1.200 2.3e-02
ovarian cancer 1.400 3.5e-04
subependymal giant cell astrocytoma -2.369 2.0e-02

Gene RIF (1)

AA Sequence

MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQSQPGLSAHMAP      1 - 70
AHQHSGALHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRRLVSHPRRSQERVSVHPHRLH     71 - 140
PSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEI    141 - 210
RNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKG    211 - 280
KKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS        281 - 346
//

Text Mined References (9)

PMID Year Title