Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Nicotine dependence 54 3.778 1.9

Gene RIF (1)

AA Sequence

MVQREKARDNFEGGCLAELIGSPRDWKCFLAVPDPLLGVQHWLHLWRPQTKDGNSLHRHGDQAWGKHRRQ      1 - 70
NSLKSPALSGHSIDYHFYPRLRCGMLIGPDKQAVASGLEVLVTSSTKILGQLFPDAAHFLEEASEFKAE      71 - 139
//

Text Mined References (6)

PMID Year Title