Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Nicotine dependence 53 3.776 1.9

Gene RIF (1)

PMID Text
23217328 Disruption of LINC00299 in subjects with neurodevelopmental disabilities implicate this particular noncoding RNA in brain development and raise the possibility that, as a class, abnormalities of lincRNAs may play a significant role in human developmental disorders.

AA Sequence

MVQREKARDNFEGGCLAELIGSPRDWKCFLAVPDPLLGVQHWLHLWRPQTKDGNSLHRHGDQAWGKHRRQ      1 - 70
NSLKSPALSGHSIDYHFYPRLRCGMLIGPDKQAVASGLEVLVTSSTKILGQLFPDAAHFLEEASEFKAE      71 - 139
//

Text Mined References (6)

PMID Year Title
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23217328 2012 Disruption of a large intergenic noncoding RNA in subjects with neurodevelopmental disabilities.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.