Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.54
PubTator Score 0.65

Knowledge Summary

Patent (59)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.78675889905947E-197
posterior fossa group A ependymoma 1511 4.15357612122345E-6
pilocytic astrocytoma 3086 0.0277383894248527

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group A ependymoma 2.300 0.000
pilocytic astrocytoma 1.100 0.028
psoriasis 3.700 0.000

Synonym

Accession Q6ZSA7 A7E2U7 B2RN81
Symbols

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLF      1 - 70
SVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSH     71 - 140
VPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNP    141 - 210
WVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFV    211 - 280
VSIASVATNFLLGITANCCHRWSKASEEEEI                                           281 - 311
//

Text Mined References (7)

PMID Year Title
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.