Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.54
PubTator Score 0.65

Knowledge Summary

Patent (59)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.8e-197
ependymoma 4679 6.0e-03
Astrocytoma, Pilocytic 3081 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.8e-02
ependymoma 1.300 6.0e-03
psoriasis 3.700 3.8e-197

Gene RIF (2)

AA Sequence

MGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLF      1 - 70
SVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSH     71 - 140
VPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNP    141 - 210
WVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFV    211 - 280
VSIASVATNFLLGITANCCHRWSKASEEEEI                                           281 - 311
//

Text Mined References (7)

PMID Year Title