Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $69,149.34
PubMed Score 0.54
PubTator Score 0.65

Knowledge Summary

Patent (59)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group A ependymoma 2.300 0.000
pilocytic astrocytoma 1.100 0.028
psoriasis 3.700 0.000

Gene RIF (2)

PMID Text
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLF      1 - 70
SVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSH     71 - 140
VPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNP    141 - 210
WVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFV    211 - 280
VSIASVATNFLLGITANCCHRWSKASEEEEI                                           281 - 311
//

Text Mined References (7)

PMID Year Title
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.