Property Summary

NCBI Gene PubMed Count 3
PubMed Score 6.79
PubTator Score 1.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSGLLTDPEQRAQEPRYPGFVLGLDVGSSVIRCHVYDRAARVCGSSVQKVENLYPQIGWVEIDPDVLWIQ      1 - 70
FVAVIKEAVKAAGIQMNQIVGLGISTQRATFITWNKKTGNHFHNFISWQDLRAVELVKSWNNSLLMKIFH     71 - 140
SSCRVLHFFTRSKRLFTASLFTFTTQQTSLRLVWILQNLTEVQKAVEEENCCFGTIDTWLLYKLTKGSVY    141 - 210
ATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVALVADQQSAM    211 - 280
FGECCFQTGDVKLTMGTGTFLDINTGNSLQQTTGGFYPLIGWKIGQEVVCLAESNAGDTGTAIKWAQQLD    281 - 350
LFTDAAETEKMAKSLEDSEGVCFVPSFSGLQAPLNDPWACASFMGLKPSTSKYHLVRAILESIAFRNKQL    351 - 420
YEMMKKEIHIPVRKIRADGGVCKNGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEELK    421 - 490
KLRQSEVVFKPQKKCQEYEMSLENWAKAVKRSMNWYNKT                                   491 - 529
//

Text Mined References (5)

PMID Year Title