Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.78
PubTator Score 9.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prolonged Electroretinal Response Suppression 2 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.6e-35
facioscapulohumeral dystrophy 288 1.5e-04
Disease Target Count Z-score Confidence
Bradyopsia 10 7.475 3.7

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 1.5e-04
psoriasis -2.300 1.6e-35

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAAD      1 - 70
ERAEFERLWVAFSGCLDLLEADMRRALELGAAFPLHAPRRPLVRTGVAGASSGVAARALSTRSLRLEAEG     71 - 140
DFDVADLRELEREVLQVGEMIDNMEMKVNVPRWTVQARQAAGAELLSTVSAGPSSVVSLQERGGGCDPRK    141 - 210
ALAAILFGAVLLAAVALAVCVAKLS                                                 211 - 235
//

Text Mined References (10)

PMID Year Title