Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZS72
Symbols C19orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRTPGSLSTNPEPLPPPLPKKILTRTQSL      1 - 70
PTRRTLHPSSIQVQPPRRPFLGSHSVDKSQAAVGPACLPAELTFGPADAPLGLSLRDLHSPEAVHTALAA     71 - 140
RQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCAESGDALYYRVVRAHEDAWHILVAKVPKPGA    141 - 210
DVPHPWGLELQASLSPHFNLQGLCGLVPEGTLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWA    211 - 280
VALLLLQLSAALKFLEAWGAALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAP    281 - 350
QLGSLLRALLSLAAPSTTPLAAGLELLAAQLTRLRPSASRTRGALQALLWGPGPELRGRGAPLGPWLRAL    351 - 420
GPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWD                     421 - 473
//

Text Mined References (4)

PMID Year Title