Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZS72
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRTPGSLSTNPEPLPPPLPKKILTRTQSL      1 - 70
PTRRTLHPSSIQVQPPRRPFLGSHSVDKSQAAVGPACLPAELTFGPADAPLGLSLRDLHSPEAVHTALAA     71 - 140
RQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCAESGDALYYRVVRAHEDAWHILVAKVPKPGA    141 - 210
DVPHPWGLELQASLSPHFNLQGLCGLVPEGTLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWA    211 - 280
VALLLLQLSAALKFLEAWGAALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAP    281 - 350
QLGSLLRALLSLAAPSTTPLAAGLELLAAQLTRLRPSASRTRGALQALLWGPGPELRGRGAPLGPWLRAL    351 - 420
GPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWD                     421 - 473
//

Text Mined References (3)

PMID Year Title
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.