Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.32
PubTator Score 2.75

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
24154973 Data implicate COLCA1 and COLCA2 in the pathogenesis of colon cancer.
24146276 We found PLCE1, C11orf92-C11orf93, and NOC3L associated with colorectal cancer susceptibility
20648012 Observational study of gene-disease association. (HuGE Navigator)
20638935 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20530476 Observational study of gene-disease association. (HuGE Navigator)
20501757 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19843678 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18753146 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQGVCKDSKDLF      1 - 70
VPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWFVAQH                     71 - 124
//

Text Mined References (16)

PMID Year Title
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24760461 2014 Identification of candidate susceptibility genes for colorectal cancer through eQTL analysis.
24256810 2014 Identification and characterization of functional risk variants for colorectal cancer mapping to chromosome 11q23.1.
24154973 2014 Identification of genes expressed by immune cells of the colon that are regulated by colorectal cancer-associated variants.
24146276 2014 Genetic association of PLCE1, C11orf92-C11orf93, and NOC3L with colorectal cancer risk in the Han population.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
21761138 2012 Meta-analysis of new genome-wide association studies of colorectal cancer risk.
20648012 2010 Association studies on 11 published colorectal cancer risk loci.
20638935 2010 Susceptibility genetic variants associated with colorectal cancer risk correlate with cancer phenotype.
20530476 2010 Risk of genome-wide association study-identified genetic variants for colorectal cancer in a Chinese population.
More...