Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.1e-07
Breast cancer -2.400 2.0e-08
group 3 medulloblastoma 2.300 1.6e-05
interstitial cystitis -1.200 9.7e-04
invasive ductal carcinoma -1.100 2.8e-02
osteosarcoma -3.467 5.2e-07
ovarian cancer -1.700 2.1e-11
psoriasis 1.500 2.7e-12

AA Sequence

MLENYGAVASLAAFPFPKPALISQLERGETPWCSVPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPL      1 - 70
NLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCGSQELWFGKTCEEKSRLGRWPG     71 - 140
YLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQIFYICEECGKCFDQNEDFDQH    141 - 210
QKTHNGEKVYGCKECGKAFSFRSHCIAHQRIHSGVKPYECQECAKAFVWKSNLIRHQRIHTGEKPFECKE    211 - 280
CGKGFSQNTSLTQHQRIHTGEKPYTCKECGKSFTRNPALLRHQRMHTGEKPYECKDCGKGFMWNSDLSQH    281 - 350
QRVHTGDKPHECTDCGKSFFCKAHLIRHQRIHTGERPYKCNDCGKAFSQNSVLIKHQRRHARDKPYNCQI    351 - 420
SHLLEH                                                                    421 - 426
//

Text Mined References (6)

PMID Year Title