Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.3e-09
COPD -1.100 1.3e-02
group 4 medulloblastoma 1.100 3.2e-02
intraductal papillary-mucinous adenoma (... -1.100 8.5e-04
intraductal papillary-mucinous carcinoma... -1.200 4.5e-03
medulloblastoma, large-cell 1.400 3.4e-05
non-small cell lung cancer -1.077 8.4e-15
ovarian cancer 1.400 1.8e-07
psoriasis 1.300 5.4e-04

 GO Function (1)

Gene RIF (1)

AA Sequence

MMSLSVRPQRRLLSARVNRSQSFAGVLGSHERGPSLSFRSFPVFSPPGPPRKPPALSRVSRMFSVAHPAA      1 - 70
KVPQPERLDLVYTALKRGLTAYLEVHQQEQEKLQGQIRESKRNSRLGFLYDLDKQVKSIERFLRRLEFHA     71 - 140
SKIDELYEAYCVQRRLRDGAYNMVRAYTTGSPGSREARDSLAEATRGHREYTESMCLLESELEAQLGEFH    141 - 210
LRMKGLAGFARLCVGDQYEICMKYGRQRWKLRGRIEGSGKQVWDSEETIFLPLLTEFLSIKVTELKGLAN    211 - 280
HVVVGSVSCETKDLFAALPQVVAVDINDLGTIKLSLEVTWSPFDKDDQPSAASSVNKASTVTKRFSTYSQ    281 - 350
SPPDTPSLREQAFYNMLRRQEELENGTAWSLSSESSDDSSSPQLSGTARHSPAPRPLVQQPEPLPIQVAF    351 - 420
RRPETPSSGPLDEEGAVAPVLANGHAPYSRTLSHISEASVDAALAEASVEAVGPESLAWGPSPPTHPAPT    421 - 490
HGEHPSPVPPALDPGHSATSSTLGTTGSVPTSTDPAPSAHLDSVHKSTDSGPSELPGPTHTTTGSTYSAI    491 - 560
TTTHSAPSPLTHTTTGSTHKPIISTLTTTGPTLNIIGPVQTTTSPTHTMPSPTHTTASPTHTSTSPTHTP    561 - 630
TSPTHKTSMSPPTTTSPTPSGMGLVQTATSPTHPTTSPTHPTTSPILINVSPSTSLELATLSSPSKHSDP    631 - 700
TLPGTDSLPCSPPVSNSYTQADPMAPRTPHPSPAHSSRKPLTSPAPDPSESTVQSLSPTPSPPTPAPQHS    701 - 770
DLCLAMAVQTPVPTAAGGSGDRSLEEALGALMAALDDYRGQFPELQGLEQEVTRLESLLMQRQGLTRSRA    771 - 840
SSLSITVEHALESFSFLNEDEDEDNDVPGDRPPSSPEAGAEDSIDSPSARPLSTGCPALDAALVRHLYHC    841 - 910
SRLLLKLGTFGPLRCQEAWALERLLREARVLEAVCEFSRRWEIPASSAQEVVQFSASRPGFLTFWDQCTE    911 - 980
RLSCFLCPVERVLLTFCNQYGARLSLRQPGLAEAVCVKFLEDALGQKLPRRPQPGPGEQLTVFQFWSFVE    981 - 1050
TLDSPTMEAYVTETAEEVLLVRNLNSDDQAVVLKALRLAPEGRLRRDGLRALSSLLVHGNNKVMAAVSTQ   1051 - 1120
LRSLSLGPTFRERALLCFLDQLEDEDVQTRVAGCLALGCIKAPEGIEPLVYLCQTDTEAVREAARQSLQQ   1121 - 1190
CGEEGQSAHRRLEESLDALPRIFGPGSMASTAF                                        1191 - 1223
//

Text Mined References (18)

PMID Year Title