Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.70
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 0.000
facioscapulohumeral dystrophy 3.600 0.000

Gene RIF (1)

PMID Text
19419970 this novel receptor has the potential to function in carbohydrate-mediated communication between cells in the germinal center

AA Sequence

MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTME      1 - 70
EEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEP     71 - 140
SPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQM    141 - 210
TWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARM    211 - 280
FCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDC    281 - 350
ATMNKGGTWNDLSCYKTTYWICERKCSC                                              351 - 378
//

Text Mined References (6)

PMID Year Title
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
19419970 2009 Prolectin, a glycan-binding receptor on dividing B cells in germinal centers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.