Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.70
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.03911865613884E-10
facioscapulohumeral dystrophy 286 1.25111756302036E-8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 0.000
facioscapulohumeral dystrophy 3.600 0.000

Synonym

Accession Q6ZS10 A8MX68 B2RTX0 B7ZMM4
Symbols

Gene

  Ortholog (3)

Species Source
Macaque OMA EggNOG
Dog OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (1)

PMID Text
19419970 this novel receptor has the potential to function in carbohydrate-mediated communication between cells in the germinal center

AA Sequence

MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTME      1 - 70
EEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEP     71 - 140
SPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQM    141 - 210
TWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARM    211 - 280
FCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDC    281 - 350
ATMNKGGTWNDLSCYKTTYWICERKCSC                                              351 - 378
//

Text Mined References (6)

PMID Year Title
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
19419970 2009 Prolectin, a glycan-binding receptor on dividing B cells in germinal centers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.