Property Summary

NCBI Gene PubMed Count 4
PubMed Score 9.78
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.0e-10
facioscapulohumeral dystrophy 288 1.3e-08

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 3.600 1.3e-08
psoriasis 2.000 3.0e-10

Gene RIF (2)

AA Sequence

MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTME      1 - 70
EEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEP     71 - 140
SPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQM    141 - 210
TWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARM    211 - 280
FCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDC    281 - 350
ATMNKGGTWNDLSCYKTTYWICERKCSC                                              351 - 378
//

Text Mined References (7)

PMID Year Title