Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLQLAGVSNSTCGGVRNVSVETRNVKPQGKDSKAEENGSHSFMHSMDPQLERQMETTQNLVDSYMAIVNK      1 - 70
TVWDLMVGAKPKTTMHIMIYNVHAPPHGDQGVHLLGAAVQPALAWEREDTHGGVGRVGTAARRDAASQSC     71 - 140
CPTCTRLGTRRHSWRSRQSRHSGATRLAWEEIDTPGGVGRAGTAARRDSRGNEKTLLEESAEQADQGVHL    141 - 210
LGAAVQPALA                                                                211 - 220
//

Text Mined References (5)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15008788 2004 DNM1DN: a new class of paralogous genomic segments (duplicons) with highly conserved copies on chromosomes Y and 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.