Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZS02 Q3ZCN3
Symbols C15orf51
DNM1DN14@
DNM1DN14.2

Gene

AA Sequence

MLQLAGVSNSTCGGVRNVSVETRNVKPQGKDSKAEENGSHSFMHSMDPQLERQMETTQNLVDSYMAIVNK      1 - 70
TVWDLMVGAKPKTTMHIMIYNVHAPPHGDQGVHLLGAAVQPALAWEREDTHGGVGRVGTAARRDAASQSC     71 - 140
CPTCTRLGTRRHSWRSRQSRHSGATRLAWEEIDTPGGVGRAGTAARRDSRGNEKTLLEESAEQADQGVHL    141 - 210
LGAAVQPALA                                                                211 - 220
//

Text Mined References (5)

PMID Year Title