Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.69
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ -1.500 1.5e-03
invasive ductal carcinoma -1.600 5.6e-03
osteosarcoma -1.393 1.7e-02
pancreatic ductal adenocarcinoma liver m... -1.584 1.8e-03
psoriasis -1.400 1.2e-55

Gene RIF (3)

AA Sequence

MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPV      1 - 70
GFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMATPNPSNVHPALGAHFIARDPY     71 - 140
DLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC     141 - 209
//

Text Mined References (9)

PMID Year Title