Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.02
PubTator Score 3.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.18442292378726E-55
ductal carcinoma in situ 1745 0.00145633326148915
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00177967505299245
invasive ductal carcinoma 2950 0.00555307716894252
osteosarcoma 7933 0.0171661659030092

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.393 0.017
pancreatic ductal adenocarcinoma liver m... -1.584 0.002
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.600 0.006
psoriasis -1.400 0.000

Synonym

Accession Q6ZRY4 A2RRG0
Symbols

Gene

PDB

2M9K  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25064856 The study shows that RBPMS2 homodimerizes through a particular sequence motif located in its RNA recognition motif domain.
23295309 RBPMS2 is up-regulated in Gastrointestinal stromal tumors compared to normal adult gastrointestinal tissues, indicating that RBPMS2 might represent a new diagnostic marker for GISTs and a potential target for cancer therapy.
22683258 RBPMS3 transcripts are up-regulation in colons of patients with chronic psuedo obstruction syndrome.

AA Sequence

MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPV      1 - 70
GFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMATPNPSNVHPALGAHFIARDPY     71 - 140
DLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC     141 - 209
//

Text Mined References (9)

PMID Year Title
25064856 2014 Homodimerization of RBPMS2 through a new RRM-interaction motif is necessary to control smooth muscle plasticity.
23295309 2013 High expression of the RNA-binding protein RBPMS2 in gastrointestinal stromal tumors.
22683258 2012 The RNA-binding protein RBPMS2 regulates development of gastrointestinal smooth muscle.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.