Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $20,362.5
PubMed Score 4.02
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.393 0.017
pancreatic ductal adenocarcinoma liver m... -1.584 0.002
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.600 0.006
psoriasis -1.400 0.000

Gene RIF (3)

PMID Text
25064856 The study shows that RBPMS2 homodimerizes through a particular sequence motif located in its RNA recognition motif domain.
23295309 RBPMS2 is up-regulated in Gastrointestinal stromal tumors compared to normal adult gastrointestinal tissues, indicating that RBPMS2 might represent a new diagnostic marker for GISTs and a potential target for cancer therapy.
22683258 RBPMS3 transcripts are up-regulation in colons of patients with chronic psuedo obstruction syndrome.

AA Sequence

MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPV      1 - 70
GFVIFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKLMATPNPSNVHPALGAHFIARDPY     71 - 140
DLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC     141 - 209
//

Text Mined References (9)

PMID Year Title
25064856 2014 Homodimerization of RBPMS2 through a new RRM-interaction motif is necessary to control smooth muscle plasticity.
23295309 2013 High expression of the RNA-binding protein RBPMS2 in gastrointestinal stromal tumors.
22683258 2012 The RNA-binding protein RBPMS2 regulates development of gastrointestinal smooth muscle.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.