Knowledge Summary

Patent

No data available

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MRCVTRTRNWWRRAARMPRAGSSAWWVAVCKQVCTRVGTYAVCWCSWNTGRFTGCPSWKDFWKPVGPALH      1 - 70
VFNVKCEAQRGLKLTQPFTVACKIDPVLCKSGLGFPPQLFTGCVYLSTYTYPWQAQAECVRCPRDSNRCK     71 - 140
RITPSACL                                                                  141 - 148
//

Text Mined References (2)

PMID Year Title