Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZRU5 A6NG26
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MRCVTRTRNWWRRAARMPRAGSSAWWVAVCKQVCTRVGTYAVCWCSWNTGRFTGCPSWKDFWKPVGPALH      1 - 70
VFNVKCEAQRGLKLTQPFTVACKIDPVLCKSGLGFPPQLFTGCVYLSTYTYPWQAQAECVRCPRDSNRCK     71 - 140
RITPSACL                                                                  141 - 148
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.