Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.5e-05
intraductal papillary-mucinous carcinoma... -1.200 7.5e-04
osteosarcoma 1.310 1.2e-04
ovarian cancer -2.300 7.7e-11
pediatric high grade glioma -1.100 6.8e-05
subependymal giant cell astrocytoma -1.373 3.7e-02

AA Sequence

MALALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSAYIGFIDGPWPFTHPGSPN      1 - 70
TPLQVHVLCLTLGYFIFDLGWCVYFQSEGALMLAHHTLSILGIIMALVLGESGTEVNAVLFGSELTNPLL     71 - 140
QMRWFLRETGHYHSFTGDVVDFLFVALFTGVRIGVGACLLFCEMVSPTPKWFVKAGGVAMYAVSWCFMFS    141 - 210
IWRFAWRKSIKKYHAWRSRRSEERQLKHNGHLKIH                                       211 - 245
//

Text Mined References (5)

PMID Year Title