Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.35
PubTator Score 4.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZRQ5 D6R9Y8 D6RBQ4 E1P529 Q5THT2 Q68CQ6 Q68D32
Symbols C6orf167
dJ39B17.2

Gene

Gene RIF (6)

PMID Text
27338793 new histones incorporated during DNA replication provide a signature of post-replicative chromatin, read by the human TONSL-MMS22L homologous recombination complex
22895565 Our data strongly suggest that targeting MMS22L as well as its interaction with NFKBIL2 could be a promising strategy for novel cancer treatments.
21113133 Results strongly suggest that the Mms22L-Nfkbil2 complex contributes to genome stability by regulating the chromatin state at stalled replication forks.
21055985 This study identifies MMS22L-NFKBIL2 as components of the replication stress control pathway.
21055984 MMS22L and TONSL are required for the maintenance of genome stability.
21055983 These results indicate that MMS22L and TONSL are genome caretakers that stimulate the recombination-dependent repair of stalled or collapsed replication forks.

AA Sequence

MENCSAASTFLTDSLELELGTEWCKPPYFSCAVDNRGGGKHFSGESYLCSGALKRLILNLDPLPTNFEED      1 - 70
TLEIFGIQWVTETALVNSSRELFHLFRQQLYNLETLLQSSCDFGKVSTLHCKADNIRQQCVLFLHYVKVF     71 - 140
IFRYLKVQNAESHVPVHPYEALEAQLPSVLIDELHGLLLYIGHLSELPSVNIGAFVNQNQIKLFPPSWHL    141 - 210
LHLHLDIHWLVLEILYMLGEKLKQVVYGHQFMNLASDNLTNISLFEEHCETLLCDLISLSLNRYDKVRSS    211 - 280
ESLMSDQCPCLCIKELWVLLIHLLDHRSKWFVSESFWNWLNKLLKTLLEKSSDRRRSSMPVIQSRDPLGF    281 - 350
SWWIITHVASFYKFDRHGVPDEMRKVESNWNFVEELLKKSISVQGVILEEQLRMYLHCCLTLCDFWEPNI    351 - 420
AIVTILWEYYSKNLNSSFSISWLPFKGLANTMKSPLSMLEMVKTCCCDKQDQELYKSSSSYTIFLCILAK    421 - 490
VVKKAMKSNGPHPWKQVKGRIYSKFHQKRMEELTEVGLQNFFSLFLLLAAVAEVEDVASHVLDLLNFLKP    491 - 560
AFVTSQRALIWKGHMAFLLMYAQKNLDIGVLAEKFSCAFREKAKEFLVSKNEEMVQRQTIWTLLSIYIDG    561 - 630
VQEVFETSYCLYPSHEKLLNDGFSMLLRACRESELRTVLSFLQAVLARIRSMHQQLCQELQRDNVDLFVQ    631 - 700
SSLSAKERHLAAVASALWRHFFSFLKSQRMSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISII    701 - 770
QLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRCVLQMYIKNLSGPDDLLIDKN    771 - 840
LEEAVEKEYMKQLVKLTRLLFNLSEVKSIFSKAQVEYLSISEDPKKALVRFFEAVGVTYGNVQTLSDKSA    841 - 910
MVTKSLEYLGEVLKYIKPYLGKKVFSAGLQLTYGMMGILVKSWAQIFATSKAQKLLFRIIDCLLLPHAVL    911 - 980
QQEKELPAPMLSAIQKSLPLYLQGMCIVCCQSQNPNAYLNQLLGNVIEQYIGRFLPASPYVSDLGQHPVL    981 - 1050
LALRNTATIPPISSLKKCIVQVIRKSYLEYKGSSPPPRLASILAFILQLFKETNTDIYEVELLLPGILKC   1051 - 1120
LVLVSEPQVKRLATENLQYMVKACQVGSEEEPSSQLTSVFRQFIQDYGMRYYYQVYSILETVATLDQQVV   1121 - 1190
IHLISTLTQSLKDSEQKWGLGRNIAQREAYSKLLSHLGQMGQDEMQRLENDNT                    1191 - 1243
//

Text Mined References (14)

PMID Year Title
27338793 2016 H4K20me0 marks post-replicative chromatin and recruits the TONSL–MMS22L DNA repair complex.
23785401 2013 Association of genetic markers with CSF oligoclonal bands in multiple sclerosis patients.
22895565 2012 Identification of a novel oncogene, MMS22L, involved in lung and esophageal carcinogenesis.
21519189 2011 Rescuing stalled replication forks: MMS22L-TONSL, a novel complex for DNA replication fork repair in human cells.
21269460 2011 Initial characterization of the human central proteome.
21113133 2010 RNAi-based screening identifies the Mms22L-Nfkbil2 complex as a novel regulator of DNA replication in human cells.
21055985 2010 A genome-wide camptothecin sensitivity screen identifies a mammalian MMS22L-NFKBIL2 complex required for genomic stability.
21055984 2010 Identification of the MMS22L-TONSL complex that promotes homologous recombination.
21055983 2010 The MMS22L-TONSL complex mediates recovery from replication stress and homologous recombination.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...