Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZRN7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSPTKDSHPSPHFPRDSGIHAPTPPDSGALTLSPPVSQGPGVGPRTGRGNRLCRPPGRSAARSFCLLPGP      1 - 70
PLGTGALGSPRAAQGLGFRGSGQRARHNSFTSPSPPGAHHPLGTHTRALPPPLARCPCAALLAGRECHGG     71 - 140
PSPAAPRPLPGTSLTWPSRAPLPRPPPRERQGPGDRSPSPSAPSCPGVGASSPRRRKPREAAGLTPDG      141 - 208
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.