Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLERNLTSMMSVEEPLPRPLTSLYIRLSILERNHMNMTYMAKSSVKIHISKVIIGFVLKRSLTNVCGKVL      1 - 70
SQNSHLVNHQRIHTGEKSYRCHECGKAFTQGSRFINHQIVHTGENFPNVLNVARLLRMALNSGLTK         71 - 136
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.