Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.27
PubTator Score 6.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (1)

AA Sequence

MEKCTKSSSTMQVEPSFLQAENLILRLQMQHPTTENTAKRGQVMPALATTVMPVPYSLEHLTQFHGDPAN      1 - 70
CSEFLTQVTTYLTALQISNPANDAQIKLFFDYLSQQLESCGIISGPDKSTLLKQYENLILEFQQSFGKPT     71 - 140
KQEINPLMNAKFDKGDNSSQQDPATFHLLAQNLICNETNQSGQFEKALADPNQDEESVTDMMDNLPDLIT    141 - 210
QCIQLDKKHSDRPELLQSETQLPLLASLIQHQALFSPTDPPPKKGPIQLREGQLPLTPAKRARQQETQLC    211 - 280
LYCSQSGHFTRDCLAKRSRAPATTNNTAHQ                                            281 - 310
//

Text Mined References (9)

PMID Year Title