Property Summary

NCBI Gene PubMed Count 6
PubMed Score 20.78
PubTator Score 6.06

Knowledge Summary


No data available

Gene RIF (1)

19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

LYCSQSGHFTRDCLAKRSRAPATTNNTAHQ                                            281 - 310

Text Mined References (8)

PMID Year Title
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.