Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.200 1.6e-03
Breast cancer -1.300 7.0e-12
ependymoma 1.800 1.3e-02
gastric cancer 1.300 2.4e-04
glioblastoma -1.100 2.8e-03
intraductal papillary-mucinous adenoma (... 1.400 3.3e-03
non primary Sjogren syndrome sicca -1.300 1.5e-02
oligodendroglioma 2.400 1.0e-03
osteosarcoma 1.531 4.6e-04
ovarian cancer -2.600 9.1e-10
pituitary cancer 1.100 6.7e-03
psoriasis -1.400 8.0e-04
Rheumatoid arthritis 1.100 2.5e-02

AA Sequence

MNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKKPFKCKKCGKSFCMLLHLC      1 - 70
QHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKYECGKSFNQDSNLTTHKRIHTGQKPYKCE     71 - 140
ECGTSFYQFSYLTRHKLIHTREKPYKCEQYGKTFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTK    141 - 210
HKIIHTEEKSHRCEEYCKAYKESSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCE    211 - 280
ECGKAYKESSHLTTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTK    281 - 350
HRIIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHTGEKPYKCE    351 - 420
ECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKPYKCEECGKAFNRSSILSI    421 - 490
HKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYKCE    491 - 560
KCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSR    561 - 630
HKIIHIGIHTEETVQK                                                          631 - 646
//

Text Mined References (6)

PMID Year Title