Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 6.98835339598559E-12
osteosarcoma 7933 3.98227331603947E-9
ovarian cancer 8492 1.49814242625826E-8
gastric cancer 436 2.39892033080432E-4
psoriasis 6685 7.98643143483033E-4
oligodendroglioma 2849 0.00103305904595647
astrocytic glioma 2241 0.00163681941425837
glioblastoma 5572 0.00280335267016892
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00329856056029694
pituitary cancer 1972 0.00673910628126588
ependymoma 2514 0.012782068617296
non primary Sjogren syndrome sicca 840 0.0146549240445345
Rheumatoid Arthritis 1171 0.0254838806017484

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.025
gastric cancer 1.300 0.000
astrocytic glioma 2.200 0.002
ependymoma 1.800 0.013
oligodendroglioma 2.400 0.001
psoriasis -1.400 0.001
osteosarcoma -3.182 0.000
glioblastoma -1.100 0.003
intraductal papillary-mucinous adenoma (... 1.400 0.003
non primary Sjogren syndrome sicca -1.300 0.015
Breast cancer -1.300 0.000
ovarian cancer -2.800 0.000
pituitary cancer 1.100 0.007

Synonym

Gene

AA Sequence

MNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKKPFKCKKCGKSFCMLLHLC      1 - 70
QHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKYECGKSFNQDSNLTTHKRIHTGQKPYKCE     71 - 140
ECGTSFYQFSYLTRHKLIHTREKPYKCEQYGKTFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTK    141 - 210
HKIIHTEEKSHRCEEYCKAYKESSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCE    211 - 280
ECGKAYKESSHLTTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTK    281 - 350
HRIIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHTGEKPYKCE    351 - 420
ECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKPYKCEECGKAFNRSSILSI    421 - 490
HKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYKCE    491 - 560
KCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSR    561 - 630
HKIIHIGIHTEETVQK                                                          631 - 646
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.