Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.025
gastric cancer 1.300 0.000
astrocytic glioma 2.200 0.002
ependymoma 1.800 0.013
oligodendroglioma 2.400 0.001
psoriasis -1.400 0.001
osteosarcoma -3.182 0.000
glioblastoma -1.100 0.003
intraductal papillary-mucinous adenoma (... 1.400 0.003
non primary Sjogren syndrome sicca -1.300 0.015
Breast cancer -1.300 0.000
ovarian cancer -2.800 0.000
pituitary cancer 1.100 0.007

AA Sequence

MNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKKPFKCKKCGKSFCMLLHLC      1 - 70
QHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKYECGKSFNQDSNLTTHKRIHTGQKPYKCE     71 - 140
ECGTSFYQFSYLTRHKLIHTREKPYKCEQYGKTFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTK    141 - 210
HKIIHTEEKSHRCEEYCKAYKESSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCE    211 - 280
ECGKAYKESSHLTTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTK    281 - 350
HRIIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHTGEKPYKCE    351 - 420
ECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKPYKCEECGKAFNRSSILSI    421 - 490
HKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCEECGKAFSIFSTLTKHKIIHTEEKPYKCE    491 - 560
KCGKTFYRFSNLNTHKIIHTGEKPCKCEECGKAFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSR    561 - 630
HKIIHIGIHTEETVQK                                                          631 - 646
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.