Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.13
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.0e-76
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypotrichosis 47 3.707 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.800 1.0e-76

Gene RIF (1)

AA Sequence

MIFMNTLRYLQTHEYLLDVDLWRLFANLEELTQTSLGFVNSLFGIIKDYVDASEISSSLDFISVLTKYFR      1 - 70
GSLCQSHQTYCLNYSAAIFYLESLRQRDDFGIYLKWCEQNEQCRRLHVPELLVAPLQRLTRYPLLLKNIW     71 - 140
KRSMDSAEKIMIYSIKEKVEKSIRDLEGKVKWLDNFQKFRYLQEIIVWPPLWDRDKRFFIPECLKHIFKE    141 - 210
HMAENILSPTSRHLLYEGKLTLAESTRFLDVYLFLFNDFLLVTKTKCNKKKLGGSDPGLMCPSLTPELQA    211 - 280
VIKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQ    281 - 350
ITTAISCFTKSQETKKISLFTLPAESSEI                                             351 - 379
//

Text Mined References (5)

PMID Year Title