Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZR03 Q2T9F2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPCRLLHQRETRSGGPRGPRHSAPTGPGWHNAPTLQSWEESHAPSRDPRDHQGSVEDTSLGGDAPADGVS      1 - 70
PSVPPLQGLGKAAGPGGTGQAECQVVVATHRANLKPWDGRAAPLGKRTEEGRLSTSSCASVSRNKPDSVP     71 - 140
QGDPVWPPESTGPALCAGEETEPQSSEGLAWGPWAQPWAPSLCPSQTGTASTASPQRASRLALQGPPGTI    141 - 210
LSLSSSSPCLPPSHCDPGAASSWAGLQSLKLLLQVSFQGAADGCSLRDANTNRKGPMHGSDFPPRLCLHS    211 - 280
MSLWGSWGSRPPSPAHSREVAS                                                    281 - 302
//

Text Mined References (2)

PMID Year Title