Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZR03 Q2T9F2
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPCRLLHQRETRSGGPRGPRHSAPTGPGWHNAPTLQSWEESHAPSRDPRDHQGSVEDTSLGGDAPADGVS      1 - 70
PSVPPLQGLGKAAGPGGTGQAECQVVVATHRANLKPWDGRAAPLGKRTEEGRLSTSSCASVSRNKPDSVP     71 - 140
QGDPVWPPESTGPALCAGEETEPQSSEGLAWGPWAQPWAPSLCPSQTGTASTASPQRASRLALQGPPGTI    141 - 210
LSLSSSSPCLPPSHCDPGAASSWAGLQSLKLLLQVSFQGAADGCSLRDANTNRKGPMHGSDFPPRLCLHS    211 - 280
MSLWGSWGSRPPSPAHSREVAS                                                    281 - 302
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.