Property Summary

NCBI Gene PubMed Count 7
PubMed Score 36.23
PubTator Score 12.03

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count
Bipolar I disorder 23
Disease Target Count P-value
ovarian cancer 8520 5.0e-18
osteosarcoma 7950 2.4e-04
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 0.8
Disease Target Count Z-score Confidence
Bipolar Disorder 666 4.513 2.3
Stiff-Person syndrome 12 3.872 1.9


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.631 2.4e-04
ovarian cancer -4.300 5.0e-18


Accession Q6ZQY3
Symbols ADC


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

NFFRQVVISPQVSREDMDFLLDEIDLLGKDM                                           491 - 521

Text Mined References (12)

PMID Year Title